Antibodies

Jump to Filters
View as table Download
OR10G9 (C-term) Rabbit Polyclonal Antibody
AP53006PU-N

USD 450.00

2 Weeks

OR10G9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen conjugated synthetic peptide between 210-240 amino acids from the C-terminal region of Human Olfactory receptor 10G9
OR10G9 Rabbit Polyclonal Antibody
TA332345

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR10G9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10G9 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10G9. Synthetic peptide located within the following region: IYLRPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLKLRDKVA
OR10G9 Rabbit Polyclonal Antibody
TA332346

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR10G9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10G9 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10G9. Synthetic peptide located within the following region: RPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLKLRDKVAHSQ