OR10G9 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 210-240 amino acids from the C-terminal region of Human Olfactory receptor 10G9 |
OR10G9 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 210-240 amino acids from the C-terminal region of Human Olfactory receptor 10G9 |
Rabbit Polyclonal Anti-OR10G9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR10G9 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10G9. Synthetic peptide located within the following region: IYLRPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLKLRDKVA |
Rabbit Polyclonal Anti-OR10G9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR10G9 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10G9. Synthetic peptide located within the following region: RPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLKLRDKVAHSQ |