Antibodies

View as table Download

Rabbit polyclonal anti-PXMP3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human PXMP3.

PEX2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the center region (between 172-202aa) of human Peroxin 2 / PEX2 / RNF72

Goat Anti-PEX2 / PXMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NATVGQSVLNIKYKN, from the Internal region of the protein sequence according to NP_000309.1.

Rabbit Polyclonal anti-Pxmp3 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pxmp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK

PEX2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human PEX2

PEX2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEX2 (NP_001165558.1).
Modifications Unmodified