Syndecan 3 (SDC3) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 411-442 amino acids from the C-terminal region of Human SDC3 |
Syndecan 3 (SDC3) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 411-442 amino acids from the C-terminal region of Human SDC3 |
Rabbit Polyclonal Anti-Sdc3 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Sdc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL |
Rabbit Polyclonal Anti-SDC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDC3 antibody is: synthetic peptide directed towards the C-terminal region of Human SDC3. Synthetic peptide located within the following region: VGGVVGALFAAFLVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEF |