Antibodies

View as table Download

SA2 (STAG2) mouse monoclonal antibody, clone 3C6, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse

SA2 (STAG2) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat
Immunogen Peptide with sequence C-SRGSTVRSKKSKPST, from the internal region of the protein sequence according to NP_001036214.1; NP_006594.3.

Goat Polyclonal Antibody against STAG2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-REPKRLRPEDS, from the internal region of the protein sequence according to NP_001036214.1; NP_001036215.1 ; NP_001036216.1 ; NP_006594.3.

Rabbit Polyclonal Anti-STAG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAG2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAG2. Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS

Rabbit Polyclonal Anti-STAG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STAG2

STAG2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human STAG2

STAG2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human STAG2

STAG2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STAG2

SA2 Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human SA2

SA2 Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SA2