Antibodies

Jump to Filters
View as table Download
SPATIAL (TBATA) (C-term) Rabbit Polyclonal Antibody
AP17908PU-N

USD 450.00

2 Weeks

SPATIAL (TBATA) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human C10orf27
SPATIAL (TBATA) Rabbit Polyclonal Antibody
TA331620

USD 375.00

5 Days

Rabbit Polyclonal Anti-TBATA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TBATA Antibody is: synthetic peptide directed towards the C-terminal region of Human TBATA. Synthetic peptide located within the following region: EPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES