Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-UBE3B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UBE3B. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-UBE3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE3B antibody: synthetic peptide directed towards the middle region of human UBE3B. Synthetic peptide located within the following region: VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE |
Carrier-free (BSA/glycerol-free) UBE3B mouse monoclonal antibody,clone OTI4E4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UBE3B mouse monoclonal antibody,clone OTI4E4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
UBE3B mouse monoclonal antibody,clone OTI4E4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
UBE3B mouse monoclonal antibody,clone OTI4E4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UBE3B mouse monoclonal antibody,clone OTI4E4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |