Rabbit Polyclonal Anti-ZNF138 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF138 antibody: synthetic peptide directed towards the middle region of human ZNF138. Synthetic peptide located within the following region: TFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYK |
Rabbit Polyclonal Anti-ZNF138 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF138 antibody: synthetic peptide directed towards the N terminal of human ZNF138. Synthetic peptide located within the following region: KRHEMVVAKHSALCSRFAQDLWLEQNIKDSFQKVTLSRYGKYGHKNLQLR |
Rabbit Polyclonal Anti-ZNF138 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF138 antibody: synthetic peptide directed towards the C terminal of human ZNF138. Synthetic peptide located within the following region: IHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYKCEECGKAFNLS |
ZNF138 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ZNF138 |
Germany
Japan
United Kingdom
China