Antibodies

View as table Download

Rabbit Polyclonal MBD2 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD2 antibody: mouse MBD2 (methyl-CpG binding domain protein 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein

Rabbit Polyclonal Anti-MBD2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the middle region of human MBD2. Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT

Rabbit polyclonal MBD2 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MBD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-279 amino acids from the Central region of human MBD2.

Goat Polyclonal Antibody against MBD2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNDPLNQNKGKPDLN, from the internal region of the protein sequence according to NP_003918.1.

Rabbit polyclonal anti-MBD2a antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 164 of rat MBD2a

Rabbit Polyclonal Anti-MBD2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the N terminal of human MBD2. Synthetic peptide located within the following region: RAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRR