Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against TUSC3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1. |
Rabbit Polyclonal Anti-TUSC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUSC3 Antibody: A synthesized peptide derived from human TUSC3 |
Goat Anti-MGAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QVEKVRTNDR, from the internal region of the protein sequence according to NP_002397.2. |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Rabbit Polyclonal Anti-Alg8 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Alg8 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF |
Anti-ALG12 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 367-488 amino acids of human ALG12, alpha-1,6-mannosyltransferase |
Anti-ALG9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 427-611 amino acids of human ALG9, alpha-1,2-mannosyltransferase |
Rabbit Polyclonal Anti-RPN1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPN1 |
Rabbit Polyclonal Anti-ALG6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ALG6 |
Rabbit Polyclonal Anti-FUT8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FUT8 |
Active filters
Reactivities
- Rat
Applications
- WB
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- N-Glycan biosynthesis