Antibodies

Jump to Filters
View as table Download
SUOX Rabbit Polyclonal Antibody
TA308158

USD 415.00

5 Days

Rabbit Polyclonal antibody to SUOX (sulfite oxidase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 291 of SUOX (Uniprot ID#P51687)
SULT1A1 Rabbit Polyclonal Antibody
TA323278

USD 345.00

4 Weeks

Anti-SULT1A1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
BPNT1 Goat Polyclonal Antibody
TA303272

USD 375.00

5 Days

Goat Polyclonal Antibody against BPNT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNYDYYASRVPESIK, from the C Terminus of the protein sequence according to NP_006076.4.
Estrogen Sulfotransferase (SULT1E1) Rabbit Polyclonal Antibody
TA318972

USD 380.00

3 Weeks

Rabbit polyclonal anti-Estrogen Sulfotransferase antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 195 of human Estrogen Sulfotransferase (EST)
CHST11 Rabbit Polyclonal Antibody
TA342376

USD 375.00

5 Days

Rabbit Polyclonal Anti-Chst11 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Chst11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS
Estrogen Sulfotransferase (SULT1E1) Rabbit Polyclonal Antibody
TA322612

USD 345.00

4 Weeks

Anti-SULT1E1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 194 amino acids of human sulfotransferase family 1E, estrogen-preferring, member 1