Antibodies

View as table Download

HCN1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human HCN1

Rabbit Polyclonal Anti-HCN2

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EEAGPAGEPRGSQAS, corresponding to amino acid residues 147-161 of human HCN2. Intracellular, N-terminus.

Rabbit Polyclonal antibody to CNGA2 (cyclic nucleotide gated channel alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 412 and 664 of CNGA2 (Uniprot ID#Q16280)

Rabbit polyclonal Anti-HCN4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with sequence HGHLHDSAEERRLIAEGDASPG EDRTPPGLAAEPERP, corresponding to amino acid residues 119-155 of human HCN4 , (MW: 31 kDa.).? ? Intracellular, N-terminus.

CNGA4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 138-168 amino acids from the N-terminal region of human CNGA4

CNGB3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 33-63 amino acids from the N-terminal region of human CNGB3

Rabbit polyclonal anti-CNGA1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CNGA1.

Rabbit Polyclonal Anti-CNGA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNGA4 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNGA4. Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ

Rabbit Polyclonal Anti-HCN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HCN3 antibody: synthetic peptide directed towards the middle region of human HCN3. Synthetic peptide located within the following region: LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV

Anti-CNGA2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 475-662 amino acids of human cyclic nucleotide gated channel alpha 2

Anti-HCN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 874-886 amino acids of Human hyperpolarization activated cyclic nucleotide-gated potassium channel 1

Anti-CNGA3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 482-605 amino acids of human cyclic nucleotide gated channel alpha 3