Antibodies

Jump to Filters
View as table Download
Rab8a
AB3176-200

USD 300.00

In Stock

Goat Polyclonal Anti-Rab8 Antibody

Applications IF, WB
Reactivities Human, Rat, Mousse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 107 aa to the C-terminus of mouse Rab8a and Rab8b produced in E. coli.
RAB8A Rabbit Polyclonal Antibody
TA330007

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAB8A Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB8A antibody: synthetic peptide directed towards the middle region of human RAB8A. Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP