Rabbit Polyclonal NORE1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Residues 313-329 [DNPQKFALFKRIHKDGQ] of the NORE1 protein. This sequence is located in the RA domain of NORE1. |
Rabbit Polyclonal NORE1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Residues 313-329 [DNPQKFALFKRIHKDGQ] of the NORE1 protein. This sequence is located in the RA domain of NORE1. |
Rabbit Polyclonal Anti-RASSF5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rassf5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rassf5. Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK |