Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-B4GALT5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT5. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-B4galt5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B4galt5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN |
B4GALT5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human B4GALT5 |
B4GALT5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human B4GALT5 (NP_004767.1). |
| Modifications | Unmodified |
B4GALT5 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human B4GALT5. AA range:321-370 |
Active filters
Target Symbol
- B4GALT5
Applications
- WB
Clonalities
- Polyclonal