Antibodies

Jump to Filters
View as table Download
CDR2 Rabbit Polyclonal Antibody
TA309603

USD 424.00

In Stock

Rabbit Polyclonal CDR2 Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human protein. [Swiss-prot# Q01850]
CDR2 Rabbit Polyclonal Antibody
TA339869

USD 310.00

5 Days

Rabbit Polyclonal Anti-CDR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDR2 antibody: synthetic peptide directed towards the N terminal of human CDR2. Synthetic peptide located within the following region: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ