Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha7 (extracellular)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KELVKNYNPLER, corresponding to amino acid residues 31-42 of rat nAChRa7. Extracellular, N-terminus. |
USD 310.00
2 Weeks
Rabbit Polyclonal Anti-CHRNA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the middle region of human CHRNA7. Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF |
USD 310.00
5 Days
Rabbit Polyclonal Anti-CHRNA7 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the N terminal of human CHRNA7. Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV |
USD 360.00
5 Days
USD 220.00
3 Weeks
CHRNA7 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-230 of human CHRNA7 (NP_001177384.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
