Antibodies

Jump to Filters
View as table Download
CNN2 Rabbit Polyclonal Antibody
TA312947

USD 345.00

In Stock

Rabbit polyclonal anti-CNN2 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CNN2.
CNN2 (N-term) Rabbit Polyclonal Antibody
AP50987PU-N

USD 450.00

2 Weeks

CNN2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 8-36 amino acids from the N-terminal region of human CNN2
CNN2 Rabbit Polyclonal Antibody
TA340047

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF
CNN2 Goat Polyclonal Antibody
TA305763

USD 375.00

5 Days

Goat Anti-Calponin 2 / CNN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPGEVPEYPPYYQEE, from the internal region (near C Terminus) of the protein sequence according to NP_004359.1; NP_958434.1.
CNN2 Rabbit Polyclonal Antibody
TA340048

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC