Antibodies

Jump to Filters
View as table Download
COCH (Center) Rabbit Polyclonal Antibody
AP51001PU-N

USD 450.00

2 Weeks

COCH (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 398-428 amino acids from the Central region of human COCH
COCH (C-term) Rabbit Polyclonal Antibody
AP51002PU-N

USD 450.00

2 Weeks

COCH (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 499-528 amino acids from the C-terminal region of human COCH
COCH Rabbit Polyclonal Antibody
TA342661

USD 375.00

5 Days

Rabbit Polyclonal Anti-COCH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COCH antibody: synthetic peptide directed towards the C terminal of human COCH. Synthetic peptide located within the following region: VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ
COCH Rabbit Polyclonal Antibody
TA342662

USD 375.00

5 Days

Rabbit Polyclonal Anti-COCH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COCH antibody: synthetic peptide directed towards the N terminal of human COCH. Synthetic peptide located within the following region: AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGK