Antibodies

View as table Download

CORO2B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CORO2B

Rabbit Polyclonal Anti-Coro2b Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Coro2b antibody is: synthetic peptide directed towards the N-terminal region of Mouse Coro2b. Synthetic peptide located within the following region: GGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTS

Rabbit Polyclonal Anti-Coro2b Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Coro2b antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGV

CORO2B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CORO2B

CORO2B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CORO2B

CORO2B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CORO2B

CORO2B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 361-480 of human CORO2B (NP_006082.3).
Modifications Unmodified