Antibodies

View as table Download

Rabbit Polyclonal Anti-Cpne7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV

Rabbit Polyclonal Anti-Cpne7 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY