Rabbit Polyclonal Anti-CPSF3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPSF3 antibody: synthetic peptide directed towards the C terminal of human CPSF3. Synthetic peptide located within the following region: DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL |
Rabbit Polyclonal Anti-CPSF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPSF3 antibody: synthetic peptide directed towards the N terminal of human CPSF3. Synthetic peptide located within the following region: MAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLI |
CPSF73 (CPSF3) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 191-221 amino acids from the Central region of Human CPSF3. |
CPSF3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 435-684 of human CPSF3 (NP_057291.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
