Rabbit polyclonal anti-Placental Lactogen antibody
Applications | WB |
Reactivities | Human |
Immunogen | E. coli expressed recombinant human Placental Lactogen |
Rabbit polyclonal anti-Placental Lactogen antibody
Applications | WB |
Reactivities | Human |
Immunogen | E. coli expressed recombinant human Placental Lactogen |
Rabbit Polyclonal Anti-CSH2 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-CSH2 antibody: synthetic peptide directed towards the middle region of human CSH2. Synthetic peptide located within the following region: LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH |