Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 11A1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 11A1.

CYP11A1 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP11A1

Rabbit Polyclonal Anti-CYP11A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1. Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW

Rabbit Polyclonal Anti-CYP11A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP11A1

CYP11A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human CP11A

CYP11A1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-320 of human CYP11A1 (NP_000772.2).
Modifications Unmodified