Antibodies

Jump to Filters
View as table Download
DPP10 Goat Polyclonal Antibody
TA303024

USD 375.00

5 Days

Goat Polyclonal Antibody against DPP10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEGHNVSEKSKYHL, from the internal region of the protein sequence according to NP_065919.2; NP_001004360.1.
DPP10 Rabbit Polyclonal Antibody
TA309628

USD 350.00

5 Days

Rabbit Polyclonal DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 521-539 of human DPP10.
DPP10 Rabbit Polyclonal Antibody
TA335318

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPP10 antibody: synthetic peptide directed towards the middle region of human DPP10. Synthetic peptide located within the following region: VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE
DPP10 Rabbit Polyclonal Antibody
TA375594

USD 220.00

3 Weeks

DPP10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPP10 (NP_001308842.1).
Modifications Unmodified