Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EN1 (Engrailed 1) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EN1 (Engrailed 1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EN1 (Engrailed 1). |
Rabbit Polyclonal Anti-EN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EN1 antibody: synthetic peptide directed towards the C terminal of human EN1. Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK |
Rabbit Polyclonal Anti-EN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EN1 antibody: synthetic peptide directed towards the middle region of human EN1. Synthetic peptide located within the following region: LNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDES |
Active filters
Target Symbol
- EN1
Applications
- WB
Clonalities
- Polyclonal