EN1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EN1 |
EN1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EN1 |
Rabbit polyclonal EN1 (Engrailed 1) Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EN1 (Engrailed 1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EN1 (Engrailed 1). |
Rabbit Polyclonal Anti-EN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EN1 antibody: synthetic peptide directed towards the C terminal of human EN1. Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK |
Rabbit Polyclonal Anti-EN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EN1 antibody: synthetic peptide directed towards the middle region of human EN1. Synthetic peptide located within the following region: LNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDES |