Antibodies

Jump to Filters
View as table Download
Factor XIII (F13B) Rabbit Polyclonal Antibody
TA346313

USD 475.00

5 Days

Rabbit Polyclonal Anti-F13B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F13B antibody: synthetic peptide directed towards the middle region of human F13B. Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
Factor XIII (F13B) Rabbit Polyclonal Antibody
TA590714

USD 409.00

In Stock

Rabbit Polyclonal Factor XIII Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
F13B Rabbit Polyclonal Antibody
TA384200

USD 380.00

4 Weeks

Factor XIII Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human F13B. AA range:500-550