Rabbit Polyclonal Anti-ZNF312 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF312 antibody: synthetic peptide directed towards the C terminal of human ZNF312. Synthetic peptide located within the following region: THNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS |
Rabbit Polyclonal Anti-ZNF312 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF312 Antibody: synthetic peptide directed towards the N terminal of human ZNF312. Synthetic peptide located within the following region: MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRP |
FEZF2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FEZF2 |
FEZF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human FEZF2 (NP_060478.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China