Antibodies

View as table Download

Goat Polyclonal Antibody against FSTL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TAEKTKRVSTKEI, from the C Terminus of the protein sequence according to NP_009016.1.

Rabbit Polyclonal FSTL1 Antibody

Applications ELISA, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

FSTL1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 285~318 amino acids from the C-terminal region of Human Follistatin-related protein 1

Rabbit Polyclonal Anti-FSTL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FSTL1 antibody: synthetic peptide directed towards the C terminal of human FSTL1. Synthetic peptide located within the following region: LNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKN

FSTL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FSTL1

FSTL1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-308 of human FSTL1 (NP_009016.1).
Modifications Unmodified