Rabbit Polyclonal Anti-FSTL5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FSTL5 antibody: synthetic peptide directed towards the middle region of human FSTL5. Synthetic peptide located within the following region: NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD |
Rabbit Polyclonal Anti-FSTL5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FSTL5 antibody: synthetic peptide directed towards the middle region of human FSTL5. Synthetic peptide located within the following region: EAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKM |
FSTL5 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-250 of human FSTL5 (NP_064501.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China