Antibodies

Jump to Filters
View as table Download
IGLL1 Rabbit Polyclonal Antibody
TA344164

USD 410.00

5 Days

Rabbit Polyclonal Anti-IGLL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IGLL1 antibody: synthetic peptide directed towards the N terminal of human IGLL1. Synthetic peptide located within the following region: RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT
IGLL1 Rabbit Polyclonal Antibody
TA384505

USD 380.00

4 Weeks

CD179b Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the C-terminal region of human IGLL1. AA range:151-200