Rabbit polyclonal Anti-KCa4.1 (Slack)
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KQEEKQNRRGLAG, corresponding to amino acid residues 619-631 of rat Slack . Intracellular, C-terminal. |
Rabbit polyclonal Anti-KCa4.1 (Slack)
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KQEEKQNRRGLAG, corresponding to amino acid residues 619-631 of rat Slack . Intracellular, C-terminal. |
Rabbit Polyclonal Anti-Kcnt1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Kcnt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKA |