Antibodies

View as table Download

Rabbit Polyclonal Anti-L3MBTL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L3MBTL2 antibody: synthetic peptide directed towards the C terminal of human L3MBTL2. Synthetic peptide located within the following region: LLEDDPQGARKISSEPVPGEIIAVRVKEEHLDVASPDKASSPELPVSVEN

Rabbit Polyclonal anti-L3MBTL2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L3MBTL2 antibody: synthetic peptide directed towards the C terminal of human L3MBTL2. Synthetic peptide located within the following region: EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ

Rabbit Polyclonal anti-L3MBTL2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L3MBTL2 antibody: synthetic peptide directed towards the N terminal of human L3MBTL2. Synthetic peptide located within the following region: DSFRSYNSSVGSESSSYLEESSEAENEDREAGELPTSPLHLLSPGTPRSL

L3MBTL2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human L3MBTL2

L3MBTL2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human L3MBTL2

L3MBTL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 486-705 of human L3MBTL2 (NP_113676.2).
Modifications Unmodified