Antibodies

View as table Download

Rabbit Polyclonal Anti-MAGEA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGEA4 antibody: synthetic peptide directed towards the C terminal of human MAGEA4. Synthetic peptide located within the following region: ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP

MAGEA4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-317 of human MAGEA4 (NP_002353.3).
Modifications Unmodified