Antibodies

View as table Download

Rabbit polyclonal anti-NOLC1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOLC1.

Rabbit Polyclonal Anti-NOLC1 Antibody

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-NOLC1 antibody: synthetic peptide directed towards the C terminal of human NOLC1. Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ

NOLC1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-699 of human NOLC1 (NP_004732.2).
Modifications Unmodified