Antibodies

Jump to Filters
View as table Download
OR5AN1 (C-term) Rabbit Polyclonal Antibody
AP53084PU-N

USD 450.00

2 Weeks

OR5AN1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 279-310 amino acids from the C-terminal region of human Olfactory receptor 5AN1
OR5AN1 Rabbit Polyclonal Antibody
TA337515

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR5AN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5AN1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5AN1. Synthetic peptide located within the following region: LSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKRKC