Antibodies

View as table Download

Rabbit Polyclonal Anti-P2Y14 Receptor (extracellular)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide CIELKSELGRKWHKASN, corresponding to amino acid residues 172-188 of human P2Y14. 2nd extracellular loop.

Rabbit Polyclonal Anti-P2RY14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI

P2RY14 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

P2RY14 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 209-338 of human P2RY14 (NP_055694.3).
Modifications Unmodified