Rabbit Polyclonal Anti-PCDH17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCDH17 antibody: synthetic peptide directed towards the C terminal of human PCDH17. Synthetic peptide located within the following region: SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK |
Goat Anti-PCDH17 (aa1098-111) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | Peptide with sequence C-RVFADVHSRASRDS, from the internal region (near C Terminus) of the protein sequence according to NP_001035519.1. |
PCDH17 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 610-710 of human PCDH17 (NP_001035519.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China