Rabbit polyclonal PNN Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PNN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-239 amino acids from the Central region of human PNN. |
Rabbit polyclonal anti-PNN antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PNN. |
Rabbit Polyclonal Anti-PNN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNN antibody: synthetic peptide directed towards the N terminal of human PNN. Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP |
Rabbit Polyclonal Anti-PNN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNN antibody: synthetic peptide directed towards the middle region of human PNN. Synthetic peptide located within the following region: RRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSR |
Rabbit Polyclonal Anti-PNN Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pnn antibody is: synthetic peptide directed towards the N-terminal region of Rat Pnn. Synthetic peptide located within the following region: EGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATSKERTRRDLI |
PNN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNN (NP_002678.2). |
PNN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNN (NP_002678.2). |
Germany
Japan
United Kingdom
China
