Antibodies

View as table Download

PUS10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PUS10

Rabbit Polyclonal Anti-PUS10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUS10 antibody: synthetic peptide directed towards the middle region of human PUS10. Synthetic peptide located within the following region: AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN

Rabbit Polyclonal Anti-PUS10 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PUS10

PUS10 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-529 of human PUS10 (NP_653310.2).
Modifications Unmodified