Antibodies

Jump to Filters
View as table Download
SNRPD1 Rabbit Polyclonal Antibody
TA345991

USD 475.00

5 Days

Rabbit Polyclonal Anti-SNRPD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
SNRPD1 Rabbit Polyclonal Antibody
TA381844

USD 220.00

3 Weeks

SNRPD1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPD1 (NP_008869.1).
Modifications Unmodified