Rabbit polyclonal anti-SYT11 antibody
Applications | WB |
Reactivities | Human, Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SYT11. |
Rabbit polyclonal anti-SYT11 antibody
Applications | WB |
Reactivities | Human, Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SYT11. |
Rabbit Polyclonal Anti-SYT11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYT11 antibody: synthetic peptide directed towards the N terminal of human SYT11. Synthetic peptide located within the following region: AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS |
Rabbit Polyclonal Anti-SYT11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYT11 antibody: synthetic peptide directed towards the N terminal of human SYT11. Synthetic peptide located within the following region: PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE |
SYT11 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SYT11 |
SYT11 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SYT11 (NP_689493.3). |
Modifications | Unmodified |