Goat Anti-TRIM11 (aa249-263) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DALRRVQDVKLQPPE, from the internal region of the protein sequence according to NP_660215.1. |
Goat Anti-TRIM11 (aa249-263) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DALRRVQDVKLQPPE, from the internal region of the protein sequence according to NP_660215.1. |
Rabbit Polyclonal Anti-TRIM11 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Trim11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETL |
TRIM11 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 267-468 of human TRIM11 (NP_660215.1). |
Modifications | Unmodified |