Antibodies

Jump to Filters
View as table Download
TRIM11 Goat Polyclonal Antibody
TA311579

USD 375.00

5 Days

Goat Anti-TRIM11 (aa249-263) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DALRRVQDVKLQPPE, from the internal region of the protein sequence according to NP_660215.1.
Trim11 Rabbit Polyclonal Antibody
TA330505

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIM11 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Trim11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETL
TRIM11 Rabbit Polyclonal Antibody
TA382803

USD 220.00

3 Weeks

TRIM11 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 267-468 of human TRIM11 (NP_660215.1).
Modifications Unmodified