VEPH1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 448-547 of human VEPH1 (NP_078897.2). |
| Modifications | Unmodified |
VEPH1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 448-547 of human VEPH1 (NP_078897.2). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-VEPH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VEPH1 antibody is: synthetic peptide directed towards the C-terminal region of Human VEPH1. Synthetic peptide located within the following region: LPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL |
VEPH1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 448-547 of human VEPH1 (NP_078897.2). |
| Modifications | Unmodified |
VEPH1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 448-547 of human VEPH1 (NP_078897.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
