Antibodies

Jump to Filters
View as table Download
ZSCAN1 Rabbit Polyclonal Antibody
TA345624

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZSCAN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZSCAN1 antibody: synthetic peptide directed towards the middle region of human ZSCAN1. Synthetic peptide located within the following region: PECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVA
ZSCAN1 Rabbit Polyclonal Antibody
TA383624

USD 220.00

3 Weeks

ZSCAN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ZSCAN1 (NP_872378.3).
Modifications Unmodified