Antibodies

Jump to Filters
View as table Download
CD57 (B3GAT1) Rabbit Polyclonal Antibody
TA351058

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-B3GAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human B3GAT1
CHST11 Rabbit Polyclonal Antibody
TA342376

USD 375.00

5 Days

Rabbit Polyclonal Anti-Chst11 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Chst11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS