Germany
Japan
United Kingdom
China
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Antibodies
View as table Download
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Rabbit polyclonal GRIN2B(Ab-1303) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Rabbit Polyclonal NMDAR2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B (Tyr1336) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1336 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR2B (Tyr1474) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1474 |
| Modifications | Phospho-specific |
Rabbit polyclonal GRIN2B (Phospho-Ser1303) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit Anti-NMDA NR2A Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Anti-NMDA NR2A Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal anti-CD40 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40 |
Anti-GRIN2B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1413-1425 amino acids of Human glutamate receptor, ionotropic, N-methyl D-aspartate 2B |
Active filters
Reactivities
- Rat
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Systemic lupus erythematosus