Antibodies

View as table Download

Goat Polyclonal Antibody against NRG3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNEIQRDSALTK, from the C Terminus of the protein sequence according to NP_001010848.2.

Rabbit Polyclonal Anti-NRG3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NRG3 Antibody: synthetic peptide directed towards the middle region of human NRG3. Synthetic peptide located within the following region: TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM

Rabbit Polyclonal Anti-NRG3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG3