Antibodies

View as table Download

Rabbit polyclonal MYT1 (Ab-83) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R).

Rabbit Polyclonal Anti-Myt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS

Rabbit Polyclonal Anti-PKMYT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PKMYT1