Rabbit polyclonal anti-TRI18/MID1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TRI18. |
Rabbit polyclonal anti-TRI18/MID1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TRI18. |
Rabbit Polyclonal Anti-MID1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MID1 antibody is: synthetic peptide directed towards the N-terminal region of Human MID1. Synthetic peptide located within the following region: PTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAF |
Rabbit Polyclonal Anti-TRI18 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRI18 Antibody: A synthesized peptide derived from human TRI18 |
Rabbit Polyclonal Anti-MID1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MID1 antibody: synthetic peptide directed towards the C terminal of human MID1. Synthetic peptide located within the following region: AINQAGSRSSEPGKLKTNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSK |