Antibodies

Jump to Filters
View as table Download
CD51 (ITGAV) Rabbit Monoclonal Antibody [Clone ID: EPR5583]
TA310958

USD 516.00

In Stock

Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA327266

USD 275.00

3 Weeks

ITGAV Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ITGAV
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA347895

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Integrin aV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA314095

USD 345.00

In Stock

Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ITGAV.
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA338302

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGAV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA323922

USD 345.00

4 Weeks

Anti-ITGAV Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1021-1034 amino acids of human integrin, alpha V